Dataset for protein Bim of organism Labrus bergylta

[Download (right click)]

1 sequence(s)

>gnl|bcl2dbpro|A0A3Q3ESW6_BCL2L11-01 BCL2-like 11 protein OS=[Eukaryota] Labrus bergylta GN=BCL2L11 (length=237 residues).
MHRPSRPPNRLDGSPTVTESHGTRGDPPQTSRSDNSGGRNFGRTDSTGGGEPDSPSRCRFKPVSPVDSLGVFQKRSIFHL
PRRASSGYFSYDGDSLPSSPLSPRPLTADKATQTPSPSGQVMQHALQRMTEAHGGGPGTQQQYGHSPSLTSRRQRTAAGD
MQAEAIGRDLQRIGDDYNRLLLWRMAGRHGRPEVHPNPQPHIQPEPTMLLCTGLMILLIGWIIYLRGNTNSHDHSQV
© 1998-2019