Dataset for protein classical BH3-containing proteins of organism Kryptolebias marmoratus

[Download (right click)] [Alignment] [Repertoires]

4 sequence(s)

>gnl|bcl2dbpro|A0A3Q2ZA20_BMF-01 Bcl2 modifying factor protein OS=[Eukaryota] Kryptolebias marmoratus GN=BMF (length=163 residues).
MDDEEDDVFEPDPSCWRTTFREIKCEDRGTQTPGPALVPHSGMLPCGVAEEPRPLFYGNAGFRLHFPARFELIRDLEARQ
QDREEEPNRMERLPRQLPVARSLEVCIGQKLQLIGDQFHREHLQQYHRNQRNQGPLWWRLTAALLSLLFDRGFIAGGGGA
GRR
>gnl|bcl2dbpro|A0A3Q3AEL8_BAD-02 BCL2-associated agonist of cell death protein OS=[Eukaryota] Kryptolebias marmoratus GN=BAD (length=166 residues).
MAAKFTISDSESEPSDEVEEGKSKQPAAGPEDGVRQRLTLPELRHSKNGRLRVNSESLSSTSSRGEEELPARADDEPGTP
TEGYPFRGRSKSAPPALWAAKKYGRQLRRMSDEFDSLLDKGEMRKVKSAGTTKQIHHSRSWWNYLFSHQETDGESSHHEK
PTHRTE
>gnl|bcl2dbpro|A0A3Q3AEL8_BAD-01 BCL2-associated agonist of cell death protein OS=[Eukaryota] Kryptolebias marmoratus GN=BAD (length=166 residues).
MAAKFTISDSESEPSDEVEEGKSKQPAAGPEDGVRQRLTLPELRHSKNGRLRVNSESLSSTSSRGEEELPARADDEPGTP
TEGYPFRGRSKSAPPALWAAKKYGRQLRRMSDEFDSLLDKGEMRKVKSAGTTKQIHHSRSWWNYLFSHQETDGESSHHEK
PTHRTE
>gnl|bcl2dbpro|A0A3Q3B113_BCL2L11-01 BCL2-like 11 protein OS=[Eukaryota] Kryptolebias marmoratus GN=BCL2L11 (length=238 residues).
MRSPSRPPNLRDGSTEVKATEGSSGGAPPSAGAARGSAHATRPVRGRAPSAAGGEPESPACSSNPPAGLDVFRSRSIFRF
PRRSSSGYFSFEGDSLPSSPLSPKPVTAEKATQTPSPTGQVMNHALQRMAVEQGGGPGTHRLHGSSPNPSGTQARNAAGD
MEAESFGRHLRTIGDEYNRLLLLRRMAGRPRRNIVPLNLLPHIHQEPVAMLCVSLLLLLIGRLMYLQGCTNSQNNSQV
© 1998-2019