Dataset for protein Bim of organism Kryptolebias marmoratus

[Download (right click)]

1 sequence(s)

>gnl|bcl2dbpro|A0A3Q3B113_BCL2L11-01 BCL2-like 11 protein OS=[Eukaryota] Kryptolebias marmoratus GN=BCL2L11 (length=238 residues).
MRSPSRPPNLRDGSTEVKATEGSSGGAPPSAGAARGSAHATRPVRGRAPSAAGGEPESPACSSNPPAGLDVFRSRSIFRF
PRRSSSGYFSFEGDSLPSSPLSPKPVTAEKATQTPSPTGQVMNHALQRMAVEQGGGPGTHRLHGSSPNPSGTQARNAAGD
MEAESFGRHLRTIGDEYNRLLLLRRMAGRPRRNIVPLNLLPHIHQEPVAMLCVSLLLLLIGRLMYLQGCTNSQNNSQV
© 1998-2019