Dataset for protein Bad of organism Kryptolebias marmoratus

[Download (right click)] [Alignment] [Repertoires]

2 sequence(s)

>gnl|bcl2dbpro|A0A3Q3AEL8_BAD-02 BCL2-associated agonist of cell death protein OS=[Eukaryota] Kryptolebias marmoratus GN=BAD (length=166 residues).
MAAKFTISDSESEPSDEVEEGKSKQPAAGPEDGVRQRLTLPELRHSKNGRLRVNSESLSSTSSRGEEELPARADDEPGTP
TEGYPFRGRSKSAPPALWAAKKYGRQLRRMSDEFDSLLDKGEMRKVKSAGTTKQIHHSRSWWNYLFSHQETDGESSHHEK
PTHRTE
>gnl|bcl2dbpro|A0A3Q3AEL8_BAD-01 BCL2-associated agonist of cell death protein OS=[Eukaryota] Kryptolebias marmoratus GN=BAD (length=166 residues).
MAAKFTISDSESEPSDEVEEGKSKQPAAGPEDGVRQRLTLPELRHSKNGRLRVNSESLSSTSSRGEEELPARADDEPGTP
TEGYPFRGRSKSAPPALWAAKKYGRQLRRMSDEFDSLLDKGEMRKVKSAGTTKQIHHSRSWWNYLFSHQETDGESSHHEK
PTHRTE
© 1998-2019