Dataset for protein classical BH3-containing proteins of organism Ictidomys tridecemlineatus

[Download (right click)] [Alignment] [Repertoires]

7 sequence(s)

>gnl|bcl2dbpro|A0A287DFJ0_BCL2L11-01 BCL2-like 11 protein OS=[Eukaryota] Ictidomys tridecemlineatus GN=BCL2L11 (length=195 residues).
MAKQPSDVSSECDREGGQLQPAERPPQLRPGAPTSLQTEPQGNPEGEGDRCPHGSPQGPLAPPASPGPFATRSPLFIFVR
RSSLLSRSSSGYFSFDTDRSPAPMSCDKSTQTPSPPCQAFNHYLSAMASMRESQAEPADMRPEIWIAQELRRIGDEFNLY
YPRRVFFNNYQPEDRPQMVILRLLRCIIRLVWRMH
>gnl|bcl2dbpro|A0A287DFJ0_BCL2L11-02 BCL2-like 11 protein OS=[Eukaryota] Ictidomys tridecemlineatus GN=BCL2L11 (length=139 residues).
MAKQPSDVSSECDREGGQLQPAERPPQLRPGAPTSLQTEPQDRSPAPMSCDKSTQTPSPPCQAFNHYLSAMASMRESQAE
PADMRPEIWIAQELRRIGDEFNLYYPRRVFFNNYQPEDRPQMVILRLLRCIIRLVWRMH
>gnl|bcl2dbpro|I3LVX0_BIK-01 BCL2-interacting killer protein OS=[Eukaryota] Ictidomys tridecemlineatus GN=BIK (length=107 residues).
MVQGSHQVALRLACIGDEMDLCFQDLQLAQLPGMAMHSLALSYSQARVTGVLRSLAQGLASLRENMWFWRPAAPSTRVPP
ARACRELLPVLLLLGLLLSRALYLRLQ
>gnl|bcl2dbpro|I3MBM5_BAD-01 BCL2-associated agonist of cell death protein OS=[Eukaryota] Ictidomys tridecemlineatus GN=BAD (length=208 residues).
MGIPEKALIASTHAPGARKSGKEGPGRKAVGPAGRRRGWHPAWTQSMFQIPEFEPSEQEDSSSAEGGLGPSPAGDRPGCG
LAPGLPRDTGHQQWQATSSSNHGGAGATETRSRHSSYPADTDLDEGMEEEPSPFRGRSRSAPPNLWAAQRYGRELRRMSD
EFEGSFKGLPRPRSAGTASQMRQSSSWTRFIQSWWDRNLGRRGSAPSQ
>gnl|bcl2dbpro|I3MBM5_BAD-02 BCL2-associated agonist of cell death protein OS=[Eukaryota] Ictidomys tridecemlineatus GN=BAD (length=178 residues).
MGIPEKALIASTHAPGARKSGKEGPGRKAVGPAGRRRGWHPAWTQSMFQIPEFEPSEQEDSSSAEGGLGPSPAGDRPGCG
LAPGLPRDTGHQQWQATSSSNHGGAGATETRSRHSSYPADTDLDEGMEEEPSPFRGRSRSAPPNLWAAQRYGRELRRMSD
EFEGSFKVTFSQSPFLRA
>gnl|bcl2dbpro|I3MDS9_BMF-02 Bcl2 modifying factor protein OS=[Eukaryota] Ictidomys tridecemlineatus GN=BMF (length=189 residues).
VFPEEMEPPQCVEELEDDVFQPEDGEPGTQPGSLLSADLFAQSQLDCPLSRLQLFPLTHCCGPGLRPTSQEDKATQTLSP
ASPSQGVMLPCGVTEEPQRLFYGNAGYRLPLPASFPAGLPLGEQPPEGQWQHRAEVQIARKLQCIADQFHRLHMQQHQQN
RNRVWWQILLFLHNLALNGDENRDRAGPR
>gnl|bcl2dbpro|I3MDS9_BMF-01 Bcl2 modifying factor protein OS=[Eukaryota] Ictidomys tridecemlineatus GN=BMF (length=258 residues).
MPRAGVFWKQYRAVRSGLLRRPPESAAAAGPASGSRLPGSGVSLPQVFITLDPGAEPWHHDSEAETLSWSHPGEMEPPQC
VEELEDDVFQPEDGEPGTQPGSLLSADLFAQSQLDCPLSRLQLFPLTHCCGPGLRPTSQEDKATQTLSPASPSQGVMLPC
GVTEEPQRLFYGNAGYRLPLPASFPAGLPLGEQPPEGQWQHRAEVQIARKLQCIADQFHRLHMQQHQQNRNRVWWQILLF
LHNLALNGDENRDRAGPR
© 1998-2018