Dataset for protein Bmf of organism Ictidomys tridecemlineatus

[Download (right click)] [Alignment] [Repertoires]

2 sequence(s)

>gnl|bcl2dbpro|I3MDS9_BMF-02 Bcl2 modifying factor protein OS=[Eukaryota] Ictidomys tridecemlineatus GN=BMF (length=189 residues).
VFPEEMEPPQCVEELEDDVFQPEDGEPGTQPGSLLSADLFAQSQLDCPLSRLQLFPLTHCCGPGLRPTSQEDKATQTLSP
ASPSQGVMLPCGVTEEPQRLFYGNAGYRLPLPASFPAGLPLGEQPPEGQWQHRAEVQIARKLQCIADQFHRLHMQQHQQN
RNRVWWQILLFLHNLALNGDENRDRAGPR
>gnl|bcl2dbpro|I3MDS9_BMF-01 Bcl2 modifying factor protein OS=[Eukaryota] Ictidomys tridecemlineatus GN=BMF (length=258 residues).
MPRAGVFWKQYRAVRSGLLRRPPESAAAAGPASGSRLPGSGVSLPQVFITLDPGAEPWHHDSEAETLSWSHPGEMEPPQC
VEELEDDVFQPEDGEPGTQPGSLLSADLFAQSQLDCPLSRLQLFPLTHCCGPGLRPTSQEDKATQTLSPASPSQGVMLPC
GVTEEPQRLFYGNAGYRLPLPASFPAGLPLGEQPPEGQWQHRAEVQIARKLQCIADQFHRLHMQQHQQNRNRVWWQILLF
LHNLALNGDENRDRAGPR
© 1998-2018