Dataset for protein Bik of organism Ictidomys tridecemlineatus

[Download (right click)]

1 sequence(s)

>gnl|bcl2dbpro|I3LVX0_BIK-01 BCL2-interacting killer protein OS=[Eukaryota] Ictidomys tridecemlineatus GN=BIK (length=107 residues).
MVQGSHQVALRLACIGDEMDLCFQDLQLAQLPGMAMHSLALSYSQARVTGVLRSLAQGLASLRENMWFWRPAAPSTRVPP
ARACRELLPVLLLLGLLLSRALYLRLQ
© 1998-2018