Dataset for protein Bad of organism Ictidomys tridecemlineatus

[Download (right click)] [Alignment] [Repertoires]

2 sequence(s)

>gnl|bcl2dbpro|I3MBM5_BAD-01 BCL2-associated agonist of cell death protein OS=[Eukaryota] Ictidomys tridecemlineatus GN=BAD (length=208 residues).
MGIPEKALIASTHAPGARKSGKEGPGRKAVGPAGRRRGWHPAWTQSMFQIPEFEPSEQEDSSSAEGGLGPSPAGDRPGCG
LAPGLPRDTGHQQWQATSSSNHGGAGATETRSRHSSYPADTDLDEGMEEEPSPFRGRSRSAPPNLWAAQRYGRELRRMSD
EFEGSFKGLPRPRSAGTASQMRQSSSWTRFIQSWWDRNLGRRGSAPSQ
>gnl|bcl2dbpro|I3MBM5_BAD-02 BCL2-associated agonist of cell death protein OS=[Eukaryota] Ictidomys tridecemlineatus GN=BAD (length=178 residues).
MGIPEKALIASTHAPGARKSGKEGPGRKAVGPAGRRRGWHPAWTQSMFQIPEFEPSEQEDSSSAEGGLGPSPAGDRPGCG
LAPGLPRDTGHQQWQATSSSNHGGAGATETRSRHSSYPADTDLDEGMEEEPSPFRGRSRSAPPNLWAAQRYGRELRRMSD
EFEGSFKVTFSQSPFLRA
© 1998-2019