Dataset for protein Hrk of organism Homo sapiens

[Download (right click)]

1 sequence(s)

>gnl|bcl2dbpro|O00198_HRK-01 Harakiri, BCL2 interacting protein protein OS=[Eukaryota] Homo sapiens GN=HRK (length=91 residues).
MCPCPLHRGRGPPAVCACSAGRLGLRSSAAQLTAARLKALGDELHQRTMWRRRARSRRAPAPGALPTYWPWLCAAAQVAA
LAAWLLGRRNL
© 1998-2018