Dataset for protein Bim of organism Homo sapiens

[Download (right click)] [Alignment] [Repertoires]

23 sequence(s)

>gnl|bcl2dbpro|A0A0C4DH20_BCL2L11-19 BCL2-like 11 protein OS=[Eukaryota] Homo sapiens GN=BCL2L11 (length=82 residues).
MAKQPSDVSSECDREGRQLQPAERPPQLRPGAPTSLQTEPQASMRQAEPADMRPEIWIAQELRRIGDEFNAYYARRMPLP
PD
>gnl|bcl2dbpro|A0A0C4DH20_BCL2L11-06 BCL2-like 11 protein OS=[Eukaryota] Homo sapiens GN=BCL2L11 (length=112 residues).
MAKQPSDVSSECDREGRQLQPAERPPQLRPGAPTSLQTEPQDRSPAPMSCDKSTQTPSPPCQAFNHYLSAMVVILEDIGD
LSLCFGFIFTGLDLYGHHHSQDTEQLNHKDFS
>gnl|bcl2dbpro|A0A0C4DH20_BCL2L11-05 BCL2-like 11 protein OS=[Eukaryota] Homo sapiens GN=BCL2L11 (length=109 residues).
MAKQPSDVSSECDREGRQLQPAERPPQLRPGAPTSLQTEPQDRSPAPMSCDKSTQTPSPPCQAFNHYLSAMASMRQAEPA
DMRPEIWIAQELRRIGDEFNAYYARRLEK
>gnl|bcl2dbpro|A0A0C4DH20_BCL2L11-02 BCL2-like 11 protein OS=[Eukaryota] Homo sapiens GN=BCL2L11 (length=138 residues).
MAKQPSDVSSECDREGRQLQPAERPPQLRPGAPTSLQTEPQDRSPAPMSCDKSTQTPSPPCQAFNHYLSAMASMRQAEPA
DMRPEIWIAQELRRIGDEFNAYYARRVFLNNYQAAEDHPRMVILRLLRYIVRLVWRMH
>gnl|bcl2dbpro|A0A0C4DH20_BCL2L11-20 BCL2-like 11 protein OS=[Eukaryota] Homo sapiens GN=BCL2L11 (length=112 residues).
MAKQPSDVSSECDREGRQLQPAERPPQLRPGAPTSLQTEPQDRSPAPMSCDKSTQTPSPPCQAFNHYLSAMVVILEDIGD
LSLCFGFIFTGLDLYGHHHSQDTEQLNHKDFS
>gnl|bcl2dbpro|A0A0C4DH20_BCL2L11-25 BCL2-like 11 protein OS=[Eukaryota] Homo sapiens GN=BCL2L11 (length=109 residues).
MAKQPSDVSSECDREGRQLQPAERPPQLRPGAPTSLQTEPQDRSPAPMSCDKSTQTPSPPCQAFNHYLSAMASMRQAEPA
DMRPEIWIAQELRRIGDEFNAYYARRLEK
>gnl|bcl2dbpro|A0A0C4DH20_BCL2L11-24 BCL2-like 11 protein OS=[Eukaryota] Homo sapiens GN=BCL2L11 (length=98 residues).
MAKQPSDVSSECDREGRQLQPAERPPQLRPGAPTSLQTEPQDRSPAPMSCDKSTQTPSPPCQAFNHYLSAMDDSAGSSLR
IALHREVQWPLKWLAKSS
>gnl|bcl2dbpro|A0A0C4DH20_BCL2L11-22 BCL2-like 11 protein OS=[Eukaryota] Homo sapiens GN=BCL2L11 (length=135 residues).
MAKQPSDVSSECDREGRQLQPAERPPQLRPGAPTSLQTEPQGNPEGNHGGEGDSCPHGSPQGPLAPPASPGPFATRSPLF
IFMRRSSLLSRSSSGYFSFDTDRSPAPMSCDKSTQTPSPPCQAFNHYLSAMANWD
>gnl|bcl2dbpro|A0A0C4DH20_BCL2L11-21 BCL2-like 11 protein OS=[Eukaryota] Homo sapiens GN=BCL2L11 (length=172 residues).
MAKQPSDVSSECDREGRQLQPAERPPQLRPGAPTSLQTEPQGNPEGNHGGEGDSCPHGSPQGPLAPPASPGPFATRSPLF
IFMRRSSLLSRSSSGYFSFDTDRSPAPMSCDKSTQTPSPPCQAFNHYLSAMASMRQAEPADMRPEIWIAQELRRIGDEFN
AYYARRMPLPPD
>gnl|bcl2dbpro|A0A0C4DH20_BCL2L11-07 BCL2-like 11 protein OS=[Eukaryota] Homo sapiens GN=BCL2L11 (length=80 residues).
MAKQPSDVSSECDREGRQLQPAERPPQLRPGAPTSLQTEPQDRSPAPMSCDKSTQTPSPPCQAFNHYLSAMVREIEEVVV
>gnl|bcl2dbpro|A0A0C4DH20_BCL2L11-09 BCL2-like 11 protein OS=[Eukaryota] Homo sapiens GN=BCL2L11 (length=172 residues).
MAKQPSDVSSECDREGRQLQPAERPPQLRPGAPTSLQTEPQGNPEGNHGGEGDSCPHGSPQGPLAPPASPGPFATRSPLF
IFMRRSSLLSRSSSGYFSFDTDRSPAPMSCDKSTQTPSPPCQAFNHYLSAMASMRQAEPADMRPEIWIAQELRRIGDEFN
AYYARRMPLPPD
>gnl|bcl2dbpro|A0A0C4DH20_BCL2L11-10 BCL2-like 11 protein OS=[Eukaryota] Homo sapiens GN=BCL2L11 (length=82 residues).
MAKQPSDVSSECDREGRQLQPAERPPQLRPGAPTSLQTEPQASMRQAEPADMRPEIWIAQELRRIGDEFNAYYARRMPLP
PD
>gnl|bcl2dbpro|A0A0C4DH20_BCL2L11-11 BCL2-like 11 protein OS=[Eukaryota] Homo sapiens GN=BCL2L11 (length=75 residues).
MAKQPSDVSSECDREGRQLQPAERPPQLRPGAPTSLQTEPQVSLCHPGWSALVRSWLTATSNSQVQAVLLPQPPK
>gnl|bcl2dbpro|A0A0C4DH20_BCL2L11-12 BCL2-like 11 protein OS=[Eukaryota] Homo sapiens GN=BCL2L11 (length=135 residues).
MAKQPSDVSSECDREGRQLQPAERPPQLRPGAPTSLQTEPQGNPEGNHGGEGDSCPHGSPQGPLAPPASPGPFATRSPLF
IFMRRSSLLSRSSSGYFSFDTDRSPAPMSCDKSTQTPSPPCQAFNHYLSAMANWD
>gnl|bcl2dbpro|A0A0C4DH20_BCL2L11-13 BCL2-like 11 protein OS=[Eukaryota] Homo sapiens GN=BCL2L11 (length=85 residues).
MAKQPSDVSSECDREGRQLQPAERPPQLRPGAPTSLQTEPQASMRQAEPADMRPEIWIAQELRRIGDEFNAYYARRLAKL
LASST
>gnl|bcl2dbpro|A0A0C4DH20_BCL2L11-15 BCL2-like 11 protein OS=[Eukaryota] Homo sapiens GN=BCL2L11 (length=85 residues).
MAKQPSDVSSECDREGRQLQPAERPPQLRPGAPTSLQTEPQASMRQAEPADMRPEIWIAQELRRIGDEFNAYYARRLAKL
LASST
>gnl|bcl2dbpro|A0A0C4DH20_BCL2L11-16 BCL2-like 11 protein OS=[Eukaryota] Homo sapiens GN=BCL2L11 (length=80 residues).
MAKQPSDVSSECDREGRQLQPAERPPQLRPGAPTSLQTEPQDRSPAPMSCDKSTQTPSPPCQAFNHYLSAMVREIEEVVV
>gnl|bcl2dbpro|A0A0C4DH20_BCL2L11-17 BCL2-like 11 protein OS=[Eukaryota] Homo sapiens GN=BCL2L11 (length=169 residues).
MAKQPSDVSSECDREGRQLQPAERPPQLRPGAPTSLQTEPQGNPEGNHGGEGDSCPHGSPQGPLAPPASPGPFATRSPLF
IFMRRSSLLSRSSSGYFSFDTDRSPAPMSCDKSTQTPSPPCQAFNHYLSAMASMRQAEPADMRPEIWIAQELRRIGDEFN
AYYARRLEK
>gnl|bcl2dbpro|Q6JTU4_BCL2L11-01 BCL2-like 11 protein OS=[Eukaryota] Homo sapiens GN=BCL2L11 (length=36 residues).
MRQAEPADMRPEIWIAQELRRIGDEFNAYYARRLEK
>gnl|bcl2dbpro|A0A0C4DH20_BCL2L11-03 BCL2-like 11 protein OS=[Eukaryota] Homo sapiens GN=BCL2L11 (length=198 residues).
MAKQPSDVSSECDREGRQLQPAERPPQLRPGAPTSLQTEPQGNPEGNHGGEGDSCPHGSPQGPLAPPASPGPFATRSPLF
IFMRRSSLLSRSSSGYFSFDTDRSPAPMSCDKSTQTPSPPCQAFNHYLSAMASMRQAEPADMRPEIWIAQELRRIGDEFN
AYYARRVFLNNYQAAEDHPRMVILRLLRYIVRLVWRMH
>gnl|bcl2dbpro|A0A0C4DH20_BCL2L11-08 BCL2-like 11 protein OS=[Eukaryota] Homo sapiens GN=BCL2L11 (length=140 residues).
MAKQPSDVSSECDREGRQLQPAERPPQLRPGAPTSLQTEPQGNPEGNHGGEGDSCPHGSPQGPLAPPASPGPFATRSPLF
IFMRRSSLLSRSSSGYFSFDTDRSPAPMSCDKSTQTPSPPCQAFNHYLSAMVREIEEVVV
>gnl|bcl2dbpro|A0A0C4DH20_BCL2L11-18 BCL2-like 11 protein OS=[Eukaryota] Homo sapiens GN=BCL2L11 (length=135 residues).
MAKQPSDVSSECDREGRQLQPAERPPQLRPGAPTSLQTEPQGNPEGNHGGEGDSCPHGSPQGPLAPPASPGPFATRSPLF
IFMRRSSLLSRSSSGYFSFDTDRSPAPMSCDKSTQTPSPPCQAFNHYLSAMGIFE
>gnl|bcl2dbpro|A0A0C4DH20_BCL2L11-23 BCL2-like 11 protein OS=[Eukaryota] Homo sapiens GN=BCL2L11 (length=140 residues).
MAKQPSDVSSECDREGRQLQPAERPPQLRPGAPTSLQTEPQGNPEGNHGGEGDSCPHGSPQGPLAPPASPGPFATRSPLF
IFMRRSSLLSRSSSGYFSFDTDRSPAPMSCDKSTQTPSPPCQAFNHYLSAMVREIEEVVV
© 1998-2018