Dataset for protein Bmf of organism Hippocampus comes

[Download (right click)] [Alignment] [Repertoires]

2 sequence(s)

>gnl|bcl2dbpro|A0A3Q2YCX7_BMF-01 Bcl2 modifying factor protein OS=[Eukaryota] Hippocampus comes GN=BMF (length=135 residues).
MEDEEDDVFEPDPHCWRTTFKEIKCEERATQTPGPVPASNNGMLPCGVAEEPRPLFYGNAGFRLHFPAHFELVGEQEERL
QESDDGMEQQLQQQQQQQPVARSIEACVGQKLQLIGDQFHREHLQLVSRNQHKHK
>gnl|bcl2dbpro|A0A3Q2YCX7_BMF-02 Bcl2 modifying factor protein OS=[Eukaryota] Hippocampus comes GN=BMF (length=135 residues).
MEDEEDDVFEPDPHCWRTTFKEIKCEERATQTPGPVPASNNGMLPCGVAEEPRPLFYGNAGFRLHFPAHFELVGEQEERL
QESDDGMEQQLQQQQQQQPVARSIEACVGQKLQLIGDQFHREHLQLVSRNQHKHK
© 1998-2019