Dataset for protein Bad of organism Hippocampus comes

[Download (right click)]

1 sequence(s)

>gnl|bcl2dbpro|A0A3Q2Y0E4_BAD-01 BCL2-associated agonist of cell death protein OS=[Eukaryota] Hippocampus comes GN=BAD (length=173 residues).
MAANFSISDSESEPSEEVEEGDDGQGAAEKEQEQCLRQGLRLTLPELPMEAMSGRIRLNSESHALAVSREEEFQARVDEE
VGTPTDGAPFRGRSKSAPPVLWAAKKYGRQLRRMSDEFDSLMDKGELKFKSAGGTSRAIHHSKTWWSYLFSHQETEGENN
NNNHHDNHANRTE
© 1998-2019