Dataset for protein Bmf of organism Haplochromis burtoni

[Download (right click)]

1 sequence(s)

>gnl|bcl2dbpro|A0A3Q3C5V2_BMF-01 Bcl2 modifying factor protein OS=[Eukaryota] Haplochromis burtoni GN=BMF (length=163 residues).
MDDEEDDVFEPKANCWRTTFREIKCEHRGTQTPGPALVPNNGMLPCGVAEEPRPLFYGNAGFRLHFPARFELVGDHRASR
QGSTEQQNSMERLPRQRPAARSVEACIGQKLQLIGDQFHWERLQLYHRNQRNQGPMWWRLAAAILSLLFDRGFIAGGGGG
GRR
© 1998-2019