Dataset for protein Bad of organism Haplochromis burtoni

[Download (right click)]

1 sequence(s)

>gnl|bcl2dbpro|A0A3Q3C680_BAD-01 BCL2-associated agonist of cell death protein OS=[Eukaryota] Haplochromis burtoni GN=BAD (length=158 residues).
MAANFKISDSDSEASEEVGEEENQQSAGQAQESKPQTLSLPVIKTTAAGRLRVNSESHTSSIARDEELMARGEDEVCTPT
EGDPFRRRSKSAPPALWAAKKYGRQLRRMSDEFDSLLDKGEMKVKKLHHSKTWWSYLFSHQETEGENNHLENHNQRTE
© 1998-2019