Dataset for protein Noxa of organism Gorilla gorilla gorilla

[Download (right click)] [Alignment] [Repertoires]

2 sequence(s)

>gnl|bcl2dbpro|A0A2I2YVQ5_PMAIP1-01 Phorbol-12-myristate-13-acetate-induced protein 1 protein OS=[Eukaryota] Gorilla gorilla gorilla GN=PMAIP1 (length=54 residues).
MPGKKARKNAQPSPARAPAELEVECATQLRRFGDKLNFRQKLLNLISKLFCSGT
>gnl|bcl2dbpro|A0A2I2YVQ5_PMAIP1-02 Phorbol-12-myristate-13-acetate-induced protein 1 protein OS=[Eukaryota] Gorilla gorilla gorilla GN=PMAIP1 (length=150 residues).
MPGKKARKNAQPSPARAPAGPAGTARDQAGFGIEMQLRFTRGKKLLSSSPLALPRGHEEQVQVAGSRVCYSTQEIWRQTE
LPAETSESDIQTLLLRNLTASKTCMRGLLQKSFLRRCTFHQFEERLHCNWEECEGAFMGALGNGRWNTSK
© 1998-2018