Dataset for protein Bmf of organism Gorilla gorilla gorilla

[Download (right click)] [Alignment] [Repertoires]

2 sequence(s)

>gnl|bcl2dbpro|G3QIN5_BMF-01 Bcl2 modifying factor protein OS=[Eukaryota] Gorilla gorilla gorilla GN=BMF (length=184 residues).
MEPSQCVEELEDDVFQPEDGEPVTQPGSLLSADLFAQSLLDCPLSRLQLFPLTHCCGPGLRPTSQEDKATQTLSPASPSQ
GVMLPCGVTEEPQRLFYGNAGYRLPLPASFPAVLPIGEQPPEGQWQHRAEVQIARKLQCIADQFHRLHVQQHQQNQNRVW
WQILLFLHNLALNGEENRNGAGPR
>gnl|bcl2dbpro|G3QIN5_BMF-02 Bcl2 modifying factor protein OS=[Eukaryota] Gorilla gorilla gorilla GN=BMF (length=129 residues).
MEPSQCVEELEDDVFQPEDGEPVTQPGSLLSADLFAQSLLDCPLSRLQLFPLTHCCGPGLRPTSQEDKATQTLSPASPSQ
GVMLPCGVTEEPQRLFYAPAEPKSCVVADPPLPAQPCFEWRREQERGRP
© 1998-2018