Dataset for protein Bik of organism Gorilla gorilla gorilla

[Download (right click)]

1 sequence(s)

>gnl|bcl2dbpro|G3QCT2_BIK-01 BCL2-interacting killer protein OS=[Eukaryota] Gorilla gorilla gorilla GN=BIK (length=160 residues).
MSEVRPLSRDILMETLLYEQLLEPPTMEVLGVTDSEEDLDPMEDFDSLECMEGSDALALRLACIGDEMDVSLRAPRLAQL
SEVAMHSLGLAFIYDQTEDIRDVLRSFMDGFTTLKENIMRFWRSPNPGSWVSREQVLLALLLLLALLLPLLSGGLHLLLK
© 1998-2018