Dataset for protein classical BH3-containing proteins of organism Gopherus agassizii

[Download (right click)] [Alignment] [Repertoires]

3 sequence(s)

>gnl|bcl2dbpro|A0A452H3N6_BMF-01 Bcl2 modifying factor protein OS=[Eukaryota] Gopherus agassizii GN=BMF (length=192 residues).
MDPPNYLEDDYSSLDGLDDDVFHSDFGLTGQPGEMTPPGIFTQNQSYSCLLGRFQLFPLTHCCGPGIRHAEQQDKATQTL
SPSSSTQDVMLPCGVTEEPQRLFYGNAGYRLHVPPVGFALNPHLQEEPREGQREALAEVQIARKLQCIADQFHRLHIQRH
QQNRNQVWWQILLFIHNLALNVEVNRNHVGQR
>gnl|bcl2dbpro|A0A452IFQ4_BAD-01 BCL2-associated agonist of cell death protein OS=[Eukaryota] Gopherus agassizii GN=BAD (length=141 residues).
MFRIQEFPDEVFPGRGKEAPAPPESQRGHTPGSKQPDTPTAEVRSRIGSDTPSLEPEVQDEPGGAFRARSRSAPPILWAA
MRYGRELRRMSDEFDVALQVLPRPKSAGTTSQLHRGNSWKETLQAWLGHRPARDALPRSSK
>gnl|bcl2dbpro|A0A452J430_PMAIP1-01 Phorbol-12-myristate-13-acetate-induced protein 1 protein OS=[Eukaryota] Gopherus agassizii GN=PMAIP1 (length=54 residues).
MPGKTLRKGAQQNPALPAQEAVTQCSLQLRKIGDICNLQQKILNVITKLFCPGT
© 1998-2019