Dataset for protein Bad of organism Gopherus agassizii

[Download (right click)]

1 sequence(s)

>gnl|bcl2dbpro|A0A452IFQ4_BAD-01 BCL2-associated agonist of cell death protein OS=[Eukaryota] Gopherus agassizii GN=BAD (length=141 residues).
MFRIQEFPDEVFPGRGKEAPAPPESQRGHTPGSKQPDTPTAEVRSRIGSDTPSLEPEVQDEPGGAFRARSRSAPPILWAA
MRYGRELRRMSDEFDVALQVLPRPKSAGTTSQLHRGNSWKETLQAWLGHRPARDALPRSSK
© 1998-2019