Dataset for protein Noxa of organism Gallus gallus

[Download (right click)]

1 sequence(s)

>gnl|bcl2dbpro|A0A1D5PAR2_PMAIP1-01 Phorbol-12-myristate-13-acetate-induced protein 1 protein OS=[Eukaryota] Gallus gallus GN=PMAIP1 (length=54 residues).
MMPGRTIRKPAPPAAPAERDAVAECALELRRIGDKADLQQKVLNLITKLFCPKT
© 1998-2018