Dataset for protein classical BH3-containing proteins of organism Gallus gallus

[Download (right click)] [Alignment] [Repertoires]

5 sequence(s)

>gnl|bcl2dbpro|A0A1D5PAR2_PMAIP1-01 Phorbol-12-myristate-13-acetate-induced protein 1 protein OS=[Eukaryota] Gallus gallus GN=PMAIP1 (length=54 residues).
MMPGRTIRKPAPPAAPAERDAVAECALELRRIGDKADLQQKVLNLITKLFCPKT
>gnl|bcl2dbpro|A9XRG9_BMF-01 Bcl2 modifying factor protein OS=[Eukaryota] Gallus gallus GN=BMF (length=135 residues).
MDRPSYLEEDYSSLDGLDDDVFHSDDFGLAGQPGEMTATGIFTQNQSYSCLLGRFQLFPLTHCCGPGVRHPEQQDKATQT
LSPSSSSQDVMLPCGVTEEPRRLFYGKSTPTSPAFQQGNYPFSTSPVRQFLSLKL
>gnl|bcl2dbpro|A9XRG9_BMF-02 Bcl2 modifying factor protein OS=[Eukaryota] Gallus gallus GN=BMF (length=193 residues).
MDRPSYLEEDYSSLDGLDDDVFHSDDFGLAGQPGEMTATGIFTQNQSYSCLLGRFQLFPLTHCCGPGVRHPEQQDKATQT
LSPSSSSQDVMLPCGVTEEPRRLFYGNAGYRLHVPPVGFALDPNLQEEPQEGQREARTEVQIARKLQCIADQFHRLHIQR
HQQNRNQVWWQLFLFLHNLALNVEANRNRTGQR
>gnl|bcl2dbpro|A9XRG9_BMF-03 Bcl2 modifying factor protein OS=[Eukaryota] Gallus gallus GN=BMF (length=193 residues).
MDRPSYLEEDYSSLDGLDDDVFHSDDFGLAGQPGEMTATGIFTQNQSYSCLLGRFQLFPLTHCCGPGVRHPEQQDKATQT
LSPSSSSQDVMLPCGVTEEPRRLFYGNAGYRLHVPPVGFALDPNLQEEPQEGQREARTEVQIARKLQCIADQFHRLHIQR
HQQNRNQVWWQLFLFLHNLALNVEANRNRTGQR
>gnl|bcl2dbpro|A9XRH0_BMF-01 Bcl2 modifying factor protein OS=[Eukaryota] Gallus gallus GN=BMF (length=118 residues).
MDRPSYLEEDYSSLDGLDDDVFHSDDFGLAGNAGYRLHVPPVGFALDPNLQEEPQEGQREARTEVQIARKLQCIADQFHR
LHIQRHQQNRNQVWWQLFLFLHNLALNVEANRNRTGQR
© 1998-2018