Dataset for protein classical BH3-containing proteins of organism Fundulus heteroclitus

[Download (right click)] [Alignment] [Repertoires]

5 sequence(s)

>gnl|bcl2dbpro|A0A3Q2PJX9_BMF-03 Bcl2 modifying factor protein OS=[Eukaryota] Fundulus heteroclitus GN=BMF (length=160 residues).
MEDEEDDVFEPDPNCWRTPFREIKCEDRGTQTPGPALAPNNGMLPCGVAEEPRQLFYGNAGFRLHFPAHFELVGDFDARR
QEEQNRMEPLPLHQPAALSLEACIGQKLQLIGDQFHREHLQQYHQNQRNQGPLWWRMTAALLSLLLDRGFVAGRGGAGRR
>gnl|bcl2dbpro|A0A3Q2PJX9_BMF-01 Bcl2 modifying factor protein OS=[Eukaryota] Fundulus heteroclitus GN=BMF (length=160 residues).
MEDEEDDVFEPDPNCWRTPFREIKCEDRGTQTPGPALAPNNGMLPCGVAEEPRQLFYGNAGFRLHFPAHFELVGDFDARR
QEEQNRMEPLPLHQPAALSLEACIGQKLQLIGDQFHREHLQQYHQNQRNQGPLWWRMTAALLSLLLDRGFVAGRGGAGRR
>gnl|bcl2dbpro|A0A3Q2PJX9_BMF-02 Bcl2 modifying factor protein OS=[Eukaryota] Fundulus heteroclitus GN=BMF (length=174 residues).
MEDEEDDVFEPDPNCWRTPFREIKCEDRGTQTPGPALAPNNGMLPCGVAEEPRQLFYGNAGFRLHFPAHFELVGDFDARR
QEEQNRMEPLPLHQPAALSLEACIGQKLQLIGDQFHREHLQQRGSFRSSLAAGEVGKPMYYTNVYSQCPTCWLANCLSRL
AAELLILCEFPTLL
>gnl|bcl2dbpro|A0A3Q2QC80_BAD-01 BCL2-associated agonist of cell death protein OS=[Eukaryota] Fundulus heteroclitus GN=BAD (length=209 residues).
MSPSSSSHIGCFPYPLRNQINSSPSCTFISGLNFPNSCLPDDTMAAKFTISDSDSEPPEEVEEEGNDQPADGKVEPLRQR
HALTLPELRSGHGRIRLNSESHASTISREEELQGRAEEEAGTPTEGLPFRNRSNSAPPALWAAKKYGRQLRRMSDEFGSL
LDKGELRKVSSAGTNRPIHHSRSWWNYLFSHQETEGENSHHENHAPRTE
>gnl|bcl2dbpro|A0A3Q2SZH6_BCL2L11-01 BCL2-like 11 protein OS=[Eukaryota] Fundulus heteroclitus GN=BCL2L11 (length=239 residues).
MVTLCSSNRPPNLRDGSTEVTPPEGTGGDPASSARTPRLSKHREGSCAQPPGAVTAAGGGGGEPDSDSPPRSISPNSLDV
FQRRSIFRKSSGYFSFDCESLPSTPLSPHPLTADKATQTASPTGQVMNHALQRMAAEHGGQPARILGLHGHSFSARQGNA
ARDMQPERFGRQLRAIGDEYNNHLMRMAGRQQRDMVPLNLMPHIQQEPVAMLCVGLLLLLIGRIMYLQGSTNSHDHSQV
© 1998-2019