Dataset for protein Bmf of organism Fundulus heteroclitus

[Download (right click)] [Alignment] [Repertoires]

3 sequence(s)

>gnl|bcl2dbpro|A0A3Q2PJX9_BMF-03 Bcl2 modifying factor protein OS=[Eukaryota] Fundulus heteroclitus GN=BMF (length=160 residues).
MEDEEDDVFEPDPNCWRTPFREIKCEDRGTQTPGPALAPNNGMLPCGVAEEPRQLFYGNAGFRLHFPAHFELVGDFDARR
QEEQNRMEPLPLHQPAALSLEACIGQKLQLIGDQFHREHLQQYHQNQRNQGPLWWRMTAALLSLLLDRGFVAGRGGAGRR
>gnl|bcl2dbpro|A0A3Q2PJX9_BMF-01 Bcl2 modifying factor protein OS=[Eukaryota] Fundulus heteroclitus GN=BMF (length=160 residues).
MEDEEDDVFEPDPNCWRTPFREIKCEDRGTQTPGPALAPNNGMLPCGVAEEPRQLFYGNAGFRLHFPAHFELVGDFDARR
QEEQNRMEPLPLHQPAALSLEACIGQKLQLIGDQFHREHLQQYHQNQRNQGPLWWRMTAALLSLLLDRGFVAGRGGAGRR
>gnl|bcl2dbpro|A0A3Q2PJX9_BMF-02 Bcl2 modifying factor protein OS=[Eukaryota] Fundulus heteroclitus GN=BMF (length=174 residues).
MEDEEDDVFEPDPNCWRTPFREIKCEDRGTQTPGPALAPNNGMLPCGVAEEPRQLFYGNAGFRLHFPAHFELVGDFDARR
QEEQNRMEPLPLHQPAALSLEACIGQKLQLIGDQFHREHLQQRGSFRSSLAAGEVGKPMYYTNVYSQCPTCWLANCLSRL
AAELLILCEFPTLL
© 1998-2019