Dataset for protein Bim of organism Fundulus heteroclitus

[Download (right click)]

1 sequence(s)

>gnl|bcl2dbpro|A0A3Q2SZH6_BCL2L11-01 BCL2-like 11 protein OS=[Eukaryota] Fundulus heteroclitus GN=BCL2L11 (length=239 residues).
MVTLCSSNRPPNLRDGSTEVTPPEGTGGDPASSARTPRLSKHREGSCAQPPGAVTAAGGGGGEPDSDSPPRSISPNSLDV
FQRRSIFRKSSGYFSFDCESLPSTPLSPHPLTADKATQTASPTGQVMNHALQRMAAEHGGQPARILGLHGHSFSARQGNA
ARDMQPERFGRQLRAIGDEYNNHLMRMAGRQQRDMVPLNLMPHIQQEPVAMLCVGLLLLLIGRIMYLQGSTNSHDHSQV
© 1998-2019