Dataset for protein Bad of organism Fundulus heteroclitus

[Download (right click)]

1 sequence(s)

>gnl|bcl2dbpro|A0A3Q2QC80_BAD-01 BCL2-associated agonist of cell death protein OS=[Eukaryota] Fundulus heteroclitus GN=BAD (length=209 residues).
MSPSSSSHIGCFPYPLRNQINSSPSCTFISGLNFPNSCLPDDTMAAKFTISDSDSEPPEEVEEEGNDQPADGKVEPLRQR
HALTLPELRSGHGRIRLNSESHASTISREEELQGRAEEEAGTPTEGLPFRNRSNSAPPALWAAKKYGRQLRRMSDEFGSL
LDKGELRKVSSAGTNRPIHHSRSWWNYLFSHQETEGENSHHENHAPRTE
© 1998-2019