Dataset for protein classical BH3-containing proteins of organism Fukomys damarensis

[Download (right click)]

1 sequence(s)

>gnl|bcl2dbpro|A0A091DDU4_BAD-01 BCL2-associated agonist of cell death protein OS=[Eukaryota] Fukomys damarensis GN=BAD (length=162 residues).
MFQIPEFEPSEQEDSSSEERGLGPSPIGDQLGPSPARGFLGDTSHQQRQLFSSRHHGGAGAMETRSRHSSYPTGTEEEEG
MEEEPSPFRGRSRSAPPNLWAAQRYGRELRRMSDEFVDSFKGLPRPKSAGTATKLWQSSSWTRAIQSWWDRNLGRGGSAP
SQ
© 1998-2018