Dataset for protein Bmf of organism Ficedula albicollis

[Download (right click)]

1 sequence(s)

>gnl|bcl2dbpro|U3JS06_BMF-01 Bcl2 modifying factor protein OS=[Eukaryota] Ficedula albicollis GN=BMF (length=193 residues).
MDRPSYLEEDYSSLDGLDDDVFHSDDFGLAGQPGEMTATGFFTQNQSYSCLLGRFQLFPLTHCCGPGIRHPEQQDKATQT
LSPSSSSQDVMLPCGVTEEPRRLFYGSAGYRLHVPPAGFVLDPHLQEEPQEGQREARAEVQIARKLQCIADQFHRLHIQR
HQQNRNQVWWQLFLFLHNLALNTEVNRNHTGQR
© 1998-2018