Dataset for protein Hrk of organism Felis catus

[Download (right click)]

1 sequence(s)

>gnl|bcl2dbpro|A0A337SQ56_HRK-01 Harakiri, BCL2 interacting protein protein OS=[Eukaryota] Felis catus GN=HRK (length=91 residues).
MCPCPLHRGRGPPAVCACSAGRLGLRSSAAQLTAARLKALGDELHQRTMWRRRARSRRAPAPGALPTYWPWLCAAAQVAA
LAAWLLGRRNL
© 1998-2019