Dataset for protein classical BH3-containing proteins of organism Felis catus

[Download (right click)] [Alignment] [Repertoires]

8 sequence(s)

>gnl|bcl2dbpro|A0A2I2UX96_BCL2L11-05 BCL2-like 11 protein OS=[Eukaryota] Felis catus GN=BCL2L11 (length=167 residues).
MAKQPSDVSSECDREGGQLQPAERPPQLRPGAPTSLQTEQQGNPEGEGDRCPQGSPQGPLAPPASPGPFATRSPFFIFVR
RSSLLSRSSSGYFSFDTDRSPAPMSCDKSTQTPSPPCQAFNHYLSAMASMRQPQAVPADMRPEIWIAQELRRIGDEFNAY
YPRRLEQ
>gnl|bcl2dbpro|A0A2I2UX96_BCL2L11-04 BCL2-like 11 protein OS=[Eukaryota] Felis catus GN=BCL2L11 (length=136 residues).
MAKQPSDVSSECDREGGQLQPAERPPQLRPGAPTSLQTEQQGNPEGEGDRCPQGSPQGPLAPPASPGPFATRSPFFIFVR
RSSLLSRSSSGYFSFDTDRSPAPMSCDKSTQTPSPPCQAFNHYLSAMVRAIEEGVL
>gnl|bcl2dbpro|A0A2I2UX96_BCL2L11-03 BCL2-like 11 protein OS=[Eukaryota] Felis catus GN=BCL2L11 (length=131 residues).
MAKQPSDVSSECDREGGQLQPAERPPQLRPGAPTSLQTEQQGNPEGEGDRCPQGSPQGPLAPPASPGPFATRSPFFIFVR
RSSLLSRSSSGYFSFDTDRSPAPMSCDKSTQTPSPPCQAFNHYLSAMGLFE
>gnl|bcl2dbpro|A0A2I2UX96_BCL2L11-02 BCL2-like 11 protein OS=[Eukaryota] Felis catus GN=BCL2L11 (length=140 residues).
MAKQPSDVSSECDREGGQLQPAERPPQLRPGAPTSLQTEQQDRSPAPMSCDKSTQTPSPPCQAFNHYLSAMASMRQPQAV
PADMRPEIWIAQELRRIGDEFNAYYPRRVFLNNYQAAEAQPQMIILRLLRYIVRLVWRLQ
>gnl|bcl2dbpro|A0A2I2UX96_BCL2L11-01 BCL2-like 11 protein OS=[Eukaryota] Felis catus GN=BCL2L11 (length=196 residues).
MAKQPSDVSSECDREGGQLQPAERPPQLRPGAPTSLQTEQQGNPEGEGDRCPQGSPQGPLAPPASPGPFATRSPFFIFVR
RSSLLSRSSSGYFSFDTDRSPAPMSCDKSTQTPSPPCQAFNHYLSAMASMRQPQAVPADMRPEIWIAQELRRIGDEFNAY
YPRRVFLNNYQAAEAQPQMIILRLLRYIVRLVWRLQ
>gnl|bcl2dbpro|A0A2I2UX96_BCL2L11-06 BCL2-like 11 protein OS=[Eukaryota] Felis catus GN=BCL2L11 (length=87 residues).
MAKQPSDVSSECDREGGQLQPAERPPQLRPGAPTSLQTEQQASMRQPQAVPADMRPEIWIAQELRRIGDEFNAYYPRRLA
RVPASYI
>gnl|bcl2dbpro|M3WRS0_BMF-02 Bcl2 modifying factor protein OS=[Eukaryota] Felis catus GN=BMF (length=130 residues).
MEPPQCVEELEDDVFQPEDVEPGTQPGSLLSANLFAQSQLDCPLSHLQLFPLTHCCGPGLRPTSQEDKATQTLSPASPSQ
GVMLPCGVTEEPQRLFYAPAKPPSSVVADSPLPTQPGFECRREQEWGRSQ
>gnl|bcl2dbpro|M3WRS0_BMF-01 Bcl2 modifying factor protein OS=[Eukaryota] Felis catus GN=BMF (length=184 residues).
MEPPQCVEELEDDVFQPEDVEPGTQPGSLLSANLFAQSQLDCPLSHLQLFPLTHCCGPGLRPTSQEDKATQTLSPASPSQ
GVMLPCGVTEEPQRLFYGNAGYRLPLPASFPAGLPLGEQPPEGHWQHRAEVQIARKLQCIADQFHRLHMQQHQQNRRRVW
WQILLFLHNLALNAEENRNGAGPR
© 1998-2018