Dataset for protein Bmf of organism Felis catus

[Download (right click)] [Alignment] [Repertoires]

2 sequence(s)

>gnl|bcl2dbpro|M3WRS0_BMF-02 Bcl2 modifying factor protein OS=[Eukaryota] Felis catus GN=BMF (length=130 residues).
MEPPQCVEELEDDVFQPEDVEPGTQPGSLLSANLFAQSQLDCPLSHLQLFPLTHCCGPGLRPTSQEDKATQTLSPASPSQ
GVMLPCGVTEEPQRLFYAPAKPPSSVVADSPLPTQPGFECRREQEWGRSQ
>gnl|bcl2dbpro|M3WRS0_BMF-01 Bcl2 modifying factor protein OS=[Eukaryota] Felis catus GN=BMF (length=184 residues).
MEPPQCVEELEDDVFQPEDVEPGTQPGSLLSANLFAQSQLDCPLSHLQLFPLTHCCGPGLRPTSQEDKATQTLSPASPSQ
GVMLPCGVTEEPQRLFYGNAGYRLPLPASFPAGLPLGEQPPEGHWQHRAEVQIARKLQCIADQFHRLHMQQHQQNRRRVW
WQILLFLHNLALNAEENRNGAGPR
© 1998-2018