Dataset for protein Puma of organism Felis catus

[Download (right click)] [Alignment] [Repertoires]

3 sequence(s)

>gnl|bcl2dbpro|A0A337SQV0_BBC3-01 BCL2 binding component 3 protein OS=[Eukaryota] Felis catus GN=BBC3 (length=255 residues).
VYLSAGAARACPRQVPGASFFPGCPRERHGPSTPGGQLPGARRGPGPRRPAPLSPQPPGALGRVLRPLRARPARRPRRPR
PAARRLPLRPHRPARRHRRPGGPPLAWGSPQPAPRAAPRRSSALTLAGRAAPGIAGAQRPGGPGGRPHPGSPGSPGGGGA
VGPGDRGPAAADGGRPQRAVRAAETRGAAATPPLTLEGPVQSHHGTPALTQGPRGPGDGAQLGACTRPVDVGDLGGRTLP
PPDALASAGDFFCTM
>gnl|bcl2dbpro|A0A337SQV0_BBC3-02 BCL2 binding component 3 protein OS=[Eukaryota] Felis catus GN=BBC3 (length=193 residues).
MARARQEGSSPEPVEGLARDGPRPFPLSRLVPSAVSCGLCEPGLPAAPAAPALLPAAYLCAPTAPPAVTAALGGPRWPGG
PRSRPRGPRPDGPQPSLSPAEQHLESPVPSAPGALAGGPTQAAPGVRGEEEQWAREIGAQLRRMADDLNALYERRRQEEQ
QRHRPSPWRVLYNLIMGLLPLPRARGAPEMEPN
>gnl|bcl2dbpro|A0A337SQV0_BBC3-03 BCL2 binding component 3 protein OS=[Eukaryota] Felis catus GN=BBC3 (length=130 residues).
YLGGGGLGESCVCARARCVGVTPWVCVACPQPSLSPAEQHLESPVPSAPGALAGGPTQAAPGVRGEEEQWAREIGAQLRR
MADDLNALYERRRQEEQQRHRPSPWRVLYNLIMGLLPLPRARGAPEMEPN
© 1998-2019