Dataset for protein Bad of organism Felis catus

[Download (right click)]

1 sequence(s)

>gnl|bcl2dbpro|A0A337SAW2_BAD-01 BCL2-associated agonist of cell death protein OS=[Eukaryota] Felis catus GN=BAD (length=273 residues).
MGTPENPLSAPTHVPGPGMSGTEQREARKGPRTKAVGREQVPRRGRRLGRKRPRPLASPGDISKADWAGSVTVPVAQATR
AGLPQYWREAAGPGQGPRDRAWAQSMFQIPEFEPSEQEDSSPTDRGLGPSPTGDRPRGPGKHQRTTPGLLGEAGHQQGQP
ASSNHHGGAGAVETRSRHSSYPAGTEEDEGTEEEEPSPFRGRSRSAPPNLWAALRYGRELRRMSDEFQGSFKGLPRPKSA
GTATQMRQSPSWTRFIQSWWDRNLGRGGSAPSQ
© 1998-2019