Dataset for protein Unclassified of organism Esox lucius

[Download (right click)]

1 sequence(s)

>gnl|bcl2dbpro|A0A3P8ZI98_uncBMF-01 Putative Bcl2 modifying factor protein OS=[Eukaryota] Esox lucius (length=159 residues).
PDSAFIDKLSKCVHVSSTSSLSALGRPLQGDQDPRHRRRRQAGQVHSDFHWVFGTPVRGTEHRGPTRHHQPHRAHIHVPF
TGNAGFRSHFPAEFEPMDDRGEGMEERQEEEQVEDSVEERIGRKLREIGDQFHEDHVQLVRVKQMCIQGWNHLFSDILF
© 1998-2019