Dataset for protein classical BH3-containing proteins of organism Esox lucius

[Download (right click)] [Alignment] [Repertoires]

6 sequence(s)

>gnl|bcl2dbpro|A0A3P8XIA2_BCL2L11-02 BCL2-like 11 protein OS=[Eukaryota] Esox lucius GN=BCL2L11 (length=132 residues).
RESSCEGNQQSRGGIMMPTNSLLGFQSRSPLFRTTSTSSSGYFSFDCDSIPSSPLLRNNKSTQTPSPSSQVITHAMRPGD
MRPEILIGQELQRIGDEFNNLFIHGVSGCSKMPVLHHLIYKPYQGPHCIKLS
>gnl|bcl2dbpro|A0A3P8XIA2_BCL2L11-01 BCL2-like 11 protein OS=[Eukaryota] Esox lucius GN=BCL2L11 (length=216 residues).
MFDSSRPQNRSNGTTTLIGRGKIGESHPCGGATSSSKLSDYPQSCEGNQQSRGGIMMPTNSLLGFQSRSPLFRTTSTSSS
GYFSFDCDSIPSSPLLRNNKSTQTPSPSSQVITHAMRRLSKPQDTWRGYEAWPTPHHPYRPRPPPIAGDMRPEILIGQEL
QRIGDEFNNLFIHGRLGARNGQVAQANLPQMHQEPAFLLWMGLLIGRLLQIIWRRR
>gnl|bcl2dbpro|A0A3P8Y761_BAD-01 BCL2-associated agonist of cell death protein OS=[Eukaryota] Esox lucius GN=BAD (length=166 residues).
MENIFTISDTESESSDVEETKKEWIAGQGKTGSRLGLSLNLPGEGRIRLNSESQVFATSGGERSGELQGLGQGLNCVATE
GLPFRVRSQSAPPALWAAKRYGRQLRRMSDEFDTWLDKGQMKRVKSAGAAKQMTTSPSWWAFLFSHKETETEKTPNLIIT
EPRSSE
>gnl|bcl2dbpro|A0A3P8ZIE7_BMF-01 Bcl2 modifying factor protein OS=[Eukaryota] Esox lucius GN=BMF (length=160 residues).
MEDEEDDVFEPDSYCWHTASREIKYEDRGTQTPTTALALLNDMLPCRLDQDPRPLFYGNAGFRLHFPAQFECVGDPGPQQ
RPQAVRGGMEHPQQLPQQPVARCIGQKLQLIGDQFHEEHLQLYHRNQRNLRPLWWRLASALLTLLWEQEAVAGGGRAGWR
>gnl|bcl2dbpro|A0A3P9A5G8_BAD-02 BCL2-associated agonist of cell death protein OS=[Eukaryota] Esox lucius GN=BAD (length=159 residues).
MAFKMDHTQDCVGDIPENINEKYDLDHLGTTHYPEFQFCNTSTNTSNRTLPGVRVRLYSESQVCSQVGRQDNTEFQVAMT
PTEESGGDAAPFRGRSQSAPPALWAAKKYGCQLRRMSDEFDTWLDKGEPKRGIIPGRAKQVYRGWFSFLWSPKEAEGRD
>gnl|bcl2dbpro|A0A3P9A5G8_BAD-01 BCL2-associated agonist of cell death protein OS=[Eukaryota] Esox lucius GN=BAD (length=159 residues).
MAFKMDHTQDCVGDIPENINEKYDLDHLGTTHYPEFQFCNTSTNTSNRTLPGVRVRLYSESQVCSQVGRQDNTEFQVAMT
PTEESGGDAAPFRGRSQSAPPALWAAKKYGCQLRRMSDEFDTWLDKGEPKRGIIPGRAKQVYRGWFSFLWSPKEAEGRD
© 1998-2019