Dataset for protein Bmf of organism Esox lucius

[Download (right click)]

1 sequence(s)

>gnl|bcl2dbpro|A0A3P8ZIE7_BMF-01 Bcl2 modifying factor protein OS=[Eukaryota] Esox lucius GN=BMF (length=160 residues).
MEDEEDDVFEPDSYCWHTASREIKYEDRGTQTPTTALALLNDMLPCRLDQDPRPLFYGNAGFRLHFPAQFECVGDPGPQQ
RPQAVRGGMEHPQQLPQQPVARCIGQKLQLIGDQFHEEHLQLYHRNQRNLRPLWWRLASALLTLLWEQEAVAGGGRAGWR
© 1998-2019