Dataset for protein classical BH3-containing proteins of organism Erinaceus europaeus

[Download (right click)]

1 sequence(s)

>gnl|bcl2dbpro|A0A1S3WU31_BMF-01 Bcl2 modifying factor protein OS=[Eukaryota] Erinaceus europaeus GN=BMF (length=184 residues).
MELPQCVDELEDDVFQPEDGEPGTTPGSLLSSDLFAQSPMDCSLSRLQLFPLTHCCGPGLRPASQEDKATQTLSPASPSQ
GVMLPCGVTEEPQRLFYGNAGYRLPLPNSFPAGSPFAEQRREGQWQQRVEVQIARKLQCIADQFHHLHMQQHQQNRNPVW
WPFLLFLHNLALNEGENRNREAPR
© 1998-2018