Dataset for protein classical BH3-containing proteins of organism Equus caballus

[Download (right click)] [Alignment] [Repertoires]

5 sequence(s)

>gnl|bcl2dbpro|F6RS78_BIK-01 BCL2-interacting killer protein OS=[Eukaryota] Equus caballus GN=BIK (length=80 residues).
MSQVGPVSRDLFLDAFLHERSPEALEVPGMTELTDSQSPSPQGEGDNRDSVAMRLAFIGDEMEVRWMLPHIAELPGVAVY
>gnl|bcl2dbpro|F6TJI0_BMF-01 Bcl2 modifying factor protein OS=[Eukaryota] Equus caballus GN=BMF (length=188 residues).
LTGDMEPPQCVEELEDDVFQPEDGEPGTQPRSLLSADLFAPSQLDCPLSHLRLFPLTHCCGPGLRPTSQEDKATQTLSPA
SPSQGVMLPCGVTEEPQRLFYGNAGYRLPLPASFPAGLPLGEQPPEGQWQHRAEVQIARKLQCIADQFHRLHMQQHQQNR
NRVWWQTLLFLHNLALNGDENRNGAGPR
>gnl|bcl2dbpro|F7A7D2_BCL2L11-01 BCL2-like 11 protein OS=[Eukaryota] Equus caballus GN=BCL2L11 (length=196 residues).
MAKQPSDVSSECDREGGQLQPAERPPQLRPGAPTSLQIEQQGNPGGEGDRCPQGSPLGPLAPPASPGPFATRSPFFIFVR
RSSLLSRSSSGYFSFDTDRSPAPMSCDKSTQTPSPPCQAFNHYLSAMASMRQSQAVPADMRPEVWIAQELRRIGDEFNAS
YPRRVVLNHHQAAEAHPQMIILRLLRYIIRLVRRLQ
>gnl|bcl2dbpro|F7CQN5_BBC3-01 BCL2 binding component 3 protein OS=[Eukaryota] Equus caballus GN=BBC3 (length=115 residues).
AGQSSRPRGPAPRGPQPSLLPAEQHLESPVPSAPGALEGGPTQAAPGVRGEEEQWAREIGAQLRRMADDLNALYERRRQE
EQQRHRPSPWRVLYNLIMGLLPLPRGRAAPEMEPN
>gnl|bcl2dbpro|F7DN67_BAD-01 BCL2-associated agonist of cell death protein OS=[Eukaryota] Equus caballus GN=BAD (length=168 residues).
MFQIPEFEQSEPEDSSPADRGLGPSPTGDWPSDPVRHQRTAPGLLGEAGHQQGQPASSSHHGGAGAVETRSRHSSYPEGT
EDEGMEGEEPGPFRGRSRSAPPNLWAARRYGRELRRMSDEFQVSFQKALPRPKSAGTATQMRQSPSWTRAIQSWWDRNLG
RGGSAPSQ
© 1998-2018