Dataset for protein classical BH3-containing proteins of organism Equus caballus

[Download (right click)] [Alignment] [Repertoires]

5 sequence(s)

>gnl|bcl2dbpro|F6RS78_BIK-02 BCL2-interacting killer protein OS=[Eukaryota] Equus caballus GN=BIK (length=226 residues).
MRKRRRHAAAKRQTWDSNSGPLVSEPRSSSSYSVPKAVWSSVGEEMSQVGPVSRDLFLDAFLHERSPEALEVPGMTELTE
SSPDSDNRDSVAMRLAFIGDEMEVRWMLPHIAELPGVAVYSLAFTYNQTGLRGVFRSFMDGLTNLRENIRFWSFLTRRDR
VSLRFHDLDSPSCMCSPLEPWSSCPVGHSLAGCHSPHQSLLSSFACFTHSSSCLFPGPLGLRWLAY
>gnl|bcl2dbpro|F6RS78_BIK-01 BCL2-interacting killer protein OS=[Eukaryota] Equus caballus GN=BIK (length=181 residues).
MSQVGPVSRDLFLDAFLHERSPEALEVPGMTELTESSPDSDNRDSVAMRLAFIGDEMEVRWMLPHIAELPGVAVYSLAFT
YNQTGLRGVFRSFMDGLTNLRENIRFWSFLTRRDRVSLRFHDLDSPSCMCSPLEPWSSCPVGHSLAGCHSPHQSLLSSFA
CFTHSSSCLFPGPLGLRWLAY
>gnl|bcl2dbpro|F6TJI0_BMF-02 Bcl2 modifying factor protein OS=[Eukaryota] Equus caballus GN=BMF (length=227 residues).
MEPPQCVEELEDDVFQPEDGEPGTQPRSLLSADLFAPSQLDCPLSHLRLFPLTHCCGPGLRPTSQEDKATQTLSPASPSQ
GVMLPCGVTEEPQRLFYGNAGYRLPLPASFPAGLPLGEQPPEGQWQHRAEVQIARKLQCIADQFHRLHMQQHQQNRNRVW
WQTLLFLHNLALNGDENRNGAGPSFQPGQEGVLWKSAGLQLPLSELLPFSPCCGTNGENLKQPVWLL
>gnl|bcl2dbpro|F6TJI0_BMF-01 Bcl2 modifying factor protein OS=[Eukaryota] Equus caballus GN=BMF (length=224 residues).
MEPPQCVEELEDDVFQPEDGEPGTQPRSLLSADLFAPSQLDCPLSHLRLFPLTHCCGPGLRPTSQEDKATQTLSPASPSQ
GVMLPCGVTEEPQRLFYGNAGYRLPLPASFPAGLPLGEQPPEGQWQHRAEVQIARKLQCIADQFHRLHMQQHQQNRNRVW
WQTLLFLHNLALNGDENRNGAGPRCGKNVRGPVRELETSDLFLSCHPELPPAPGFCQDFVLSWS
>gnl|bcl2dbpro|F7DN67_BAD-01 BCL2-associated agonist of cell death protein OS=[Eukaryota] Equus caballus GN=BAD (length=213 residues).
MGTPENPSPAPTHAQGTRKSTAEHPETRRGPRKEGGGRRAGPAAGSMFQIPEFEQSEPEDSSPADRGLGPSPTGDWPSDP
VRHQRTAPGLLGEAGHQQGQPASSSHHGGAGAVETRSRHSSYPEGTEDEGMEGEEPGPFRGRSRSAPPNLWAARRYGREL
RRMSDEFQVSFQALPRPKSAGTATQMRQSPSWTRAIQSWWDRNLGRGGSAPSQ
© 1998-2019