Dataset for protein Bmf of organism Equus caballus

[Download (right click)]

1 sequence(s)

>gnl|bcl2dbpro|F6TJI0_BMF-01 Bcl2 modifying factor protein OS=[Eukaryota] Equus caballus GN=BMF (length=188 residues).
LTGDMEPPQCVEELEDDVFQPEDGEPGTQPRSLLSADLFAPSQLDCPLSHLRLFPLTHCCGPGLRPTSQEDKATQTLSPA
SPSQGVMLPCGVTEEPQRLFYGNAGYRLPLPASFPAGLPLGEQPPEGQWQHRAEVQIARKLQCIADQFHRLHMQQHQQNR
NRVWWQTLLFLHNLALNGDENRNGAGPR
© 1998-2018