Dataset for protein Bik of organism Equus caballus

[Download (right click)]

1 sequence(s)

>gnl|bcl2dbpro|F6RS78_BIK-01 BCL2-interacting killer protein OS=[Eukaryota] Equus caballus GN=BIK (length=80 residues).
MSQVGPVSRDLFLDAFLHERSPEALEVPGMTELTDSQSPSPQGEGDNRDSVAMRLAFIGDEMEVRWMLPHIAELPGVAVY
© 1998-2019