Dataset for protein Puma of organism Equus caballus

[Download (right click)]

1 sequence(s)

>gnl|bcl2dbpro|F7CQN5_BBC3-01 BCL2 binding component 3 protein OS=[Eukaryota] Equus caballus GN=BBC3 (length=115 residues).
AGQSSRPRGPAPRGPQPSLLPAEQHLESPVPSAPGALEGGPTQAAPGVRGEEEQWAREIGAQLRRMADDLNALYERRRQE
EQQRHRPSPWRVLYNLIMGLLPLPRGRAAPEMEPN
© 1998-2018