Dataset for protein classical BH3-containing proteins of organism Dipodomys ordii

[Download (right click)] [Alignment] [Repertoires]

6 sequence(s)

>gnl|bcl2dbpro|A0A1S3EQA2_BMF-02 Bcl2 modifying factor protein OS=[Eukaryota] Dipodomys ordii GN=BMF (length=181 residues).
IVPGEMEPPQCVEELEDDVFQAEDGEPGTQPGSLLSATLFAQSQLDCPLSRLQLFPLTHCCGPGLRPTSQEDKATQTLSP
ASPSQGVMLPCGVTEEPQRLFYGSAGYRLPLPAGFPAAQQPPEGHRVEVQIARKLQCIADQFHRLHTQRHQQHRDRAWGQ
VLLFLHNLALNRENRDRAGPR
>gnl|bcl2dbpro|A0A1S3EQA2_BMF-01 Bcl2 modifying factor protein OS=[Eukaryota] Dipodomys ordii GN=BMF (length=176 residues).
MEPPQCVEELEDDVFQAEDGEPGTQPGSLLSATLFAQSQLDCPLSRLQLFPLTHCCGPGLRPTSQEDKATQTLSPASPSQ
GVMLPCGVTEEPQRLFYGSAGYRLPLPAGFPAAQQPPEGHRVEVQIARKLQCIADQFHRLHTQRHQQHRDRAWGQVLLFL
HNLALNRENRDRAGPR
>gnl|bcl2dbpro|A0A1S3FHA8_BCL2L11-01 BCL2-like 11 protein OS=[Eukaryota] Dipodomys ordii GN=BCL2L11 (length=200 residues).
MAKQPSDVSSECDREGGQLQPAERPPQLRPGAPTSLQTEQQGNPEGSPEGEGDRCPQGSPQGPLAPPASPGPFATRSPLF
IFVRRSSLLSRSSSGYFSFDTDRSPAPMSCDKSTQTPSPPCQAFNHYLSAMASMRQSQEEPADLRPEIWIAQELRRIGDE
FDAYYPRRVFLNNYQAAEDQPQMVILRLLRYIIRLVWRMH
>gnl|bcl2dbpro|A0A1S3FHA8_BCL2L11-02 BCL2-like 11 protein OS=[Eukaryota] Dipodomys ordii GN=BCL2L11 (length=140 residues).
MAKQPSDVSSECDREGGQLQPAERPPQLRPGAPTSLQTEQQDRSPAPMSCDKSTQTPSPPCQAFNHYLSAMASMRQSQEE
PADLRPEIWIAQELRRIGDEFDAYYPRRVFLNNYQAAEDQPQMVILRLLRYIIRLVWRMH
>gnl|bcl2dbpro|A0A1S3FL84_BAD-01 BCL2-associated agonist of cell death protein OS=[Eukaryota] Dipodomys ordii GN=BAD (length=154 residues).
MFQIPEFEPSEQEDSSSADRGLGPSLCPAPGLLGDHSPQQGLPTSRSHHGGAGAVETRSRHSSYPAGMEEDEGLEEEPSP
FRGRSRSAPPNLWAARRYGRELRRMSDEFDGSFKGLPRPKSAGTATQMRQSSSWTRIFQSWWDRNLGRGSAPSQ
>gnl|bcl2dbpro|A0A1S3FUQ7_BIK-01 BCL2-interacting killer protein OS=[Eukaryota] Dipodomys ordii GN=BIK (length=149 residues).
MSEAGSVTRDLFIKTLLYQQMPGPRPAAGLFPITEPMGEEVWDPMDCLEGSNQVALWLVCIGDEMDQRLRSPRLAQLPGM
AIHSLALTYSQMGVWGVLRRLIRGVAHLRAHIRAWRPPIPRLQVSPGQVRRQMLPAVLLLCGALQLLLQ
© 1998-2018