Dataset for protein Bmf of organism Dipodomys ordii

[Download (right click)] [Alignment] [Repertoires]

2 sequence(s)

>gnl|bcl2dbpro|A0A1S3EQA2_BMF-02 Bcl2 modifying factor protein OS=[Eukaryota] Dipodomys ordii GN=BMF (length=181 residues).
IVPGEMEPPQCVEELEDDVFQAEDGEPGTQPGSLLSATLFAQSQLDCPLSRLQLFPLTHCCGPGLRPTSQEDKATQTLSP
ASPSQGVMLPCGVTEEPQRLFYGSAGYRLPLPAGFPAAQQPPEGHRVEVQIARKLQCIADQFHRLHTQRHQQHRDRAWGQ
VLLFLHNLALNRENRDRAGPR
>gnl|bcl2dbpro|A0A1S3EQA2_BMF-01 Bcl2 modifying factor protein OS=[Eukaryota] Dipodomys ordii GN=BMF (length=176 residues).
MEPPQCVEELEDDVFQAEDGEPGTQPGSLLSATLFAQSQLDCPLSRLQLFPLTHCCGPGLRPTSQEDKATQTLSPASPSQ
GVMLPCGVTEEPQRLFYGSAGYRLPLPAGFPAAQQPPEGHRVEVQIARKLQCIADQFHRLHTQRHQQHRDRAWGQVLLFL
HNLALNRENRDRAGPR
© 1998-2018