Dataset for protein Bik of organism Dipodomys ordii

[Download (right click)]

1 sequence(s)

>gnl|bcl2dbpro|A0A1S3FUQ7_BIK-01 BCL2-interacting killer protein OS=[Eukaryota] Dipodomys ordii GN=BIK (length=149 residues).
MSEAGSVTRDLFIKTLLYQQMPGPRPAAGLFPITEPMGEEVWDPMDCLEGSNQVALWLVCIGDEMDQRLRSPRLAQLPGM
AIHSLALTYSQMGVWGVLRRLIRGVAHLRAHIRAWRPPIPRLQVSPGQVRRQMLPAVLLLCGALQLLLQ
© 1998-2018