Dataset for protein Bad of organism Dipodomys ordii

[Download (right click)]

1 sequence(s)

>gnl|bcl2dbpro|A0A1S3FL84_BAD-01 BCL2-associated agonist of cell death protein OS=[Eukaryota] Dipodomys ordii GN=BAD (length=154 residues).
MFQIPEFEPSEQEDSSSADRGLGPSLCPAPGLLGDHSPQQGLPTSRSHHGGAGAVETRSRHSSYPAGMEEDEGLEEEPSP
FRGRSRSAPPNLWAARRYGRELRRMSDEFDGSFKGLPRPKSAGTATQMRQSSSWTRIFQSWWDRNLGRGSAPSQ
© 1998-2018