Dataset for protein Unclassified of organism Danio rerio

[Download (right click)]

3 sequence(s)

>gnl|bcl2dbpro|A0A2R8RYV1_uncBMF-01 Putative Bcl2 modifying factor protein OS=[Eukaryota] Danio rerio (length=226 residues).
MDDEEDEQLPRCCETPLRNKRSEKRDAHGGDVGQTAHRHASTQTAGSVLNSARDADMAPFQGSQREASSLCRVVGARTAF
RAPCGTGGLVSLTMGPGARGGPRALFHGNAGFRAHFPALFEPALDGLQNAEQREQDEGRPEEKEEDRDAGISVEVQIGRK
LREMGDQFQQEHLQLVRVIHIRLILFFKAAGFQMCVVRNWWFQSRCKMTSLSAISVLNMQIPKREQ
>gnl|bcl2dbpro|Q0GKC4_uncBMF-01 Putative Bcl2 modifying factor protein OS=[Eukaryota] Danio rerio (length=208 residues).
MDDEEDEQLPRCCETPLRNKRSEKRDAHGGDVGQTAHRHASTQTAGSVLNSARDADMAPFQGSQREASSLCRVVGARTAF
RAPCGTGGLVSLTMGPGARGGPRALFHGNAGFRAHFPALFEPALDGLQNAEQREQDEGRPEEKEEDRDAGISVEVQIGRK
LREMGDQFQQEHLQLFTQRGQMGLFQLMTSIYNFLFPQERPQNARAHR
>gnl|bcl2dbpro|Q0GKC4_uncBMF-02 Putative Bcl2 modifying factor protein OS=[Eukaryota] Danio rerio (length=226 residues).
MDDEEDEQLPRCCETPLRNKRSEKRDAHGGDVGQTAHRHASTQTAGSVLNSARDADMAPFQGSQREASSLCRVVGARTAF
RAPCGTGGLVSLTMGPGARGGPRALFHGNAGFRAHFPALFEPALDGLQNAEQREQDEGRPEEKEEDRDAGISVEVQIGRK
LREMGDQFQQEHLQLVRVIHIRLILFFKAAGFQMCVVRNWWFQSRCKMTSLSAISVLNMQIPKRER
© 1998-2018