Dataset for protein classical BH3-containing proteins of organism Danio rerio

[Download (right click)] [Alignment] [Repertoires]

10 sequence(s)

>gnl|bcl2dbpro|A7MCM4_BAD-01 BCL2-associated agonist of cell death protein OS=[Eukaryota] Danio rerio GN=BAD (length=147 residues).
MAHMFNISDDSETETMEDSEASSLDKHKSGSAQKKQHLTVPDRLKGEQLGRQRNLSMNEEDLLETGVAEDPHMLGDPFRP
RSRSAPPALWAAKKYGQQLRRMSDEFDKGQMKRVKSAGTARQMSQSPSWLAFLWSHKESDAESRPAE
>gnl|bcl2dbpro|B2KKY9_BCL2L11-01 BCL2-like 11 protein OS=[Eukaryota] Danio rerio GN=BCL2L11 (length=176 residues).
MSDTSREQTLANGPASQGSGESTGGGVVLPAGHFDFPQPGEGDPLRGGISMSNNQSRSPMNRTFSRSSSGYFSVDSDSVP
GSPLMPNISEAQDGQNDEVWLSEHSHQHLQMAAPVAALPPEMVVARELRRIGDEFNRLYCEAGAGVNQLRAPNEHAIVLW
MNVIIGRLVHFFLRRR
>gnl|bcl2dbpro|B8JK68_BCL2L11-01 BCL2-like 11 protein OS=[Eukaryota] Danio rerio GN=BCL2L11 (length=176 residues).
MSDTSREQTLANGPASQGSGESTGGGVVLPAGHFDFPQPGEGDPLRGGISMSNNQSRSPMNRTFSRSSSGYFSVDSDSVP
GSPLMPNISEAQDGQNDEVWLSEHSHQHLQMAAPVAALPPEMVVARELRRIGDEFNRLYCEAGAGVNQLHAPNEHAIVLW
MNDIIGRLVHFFLRRR
>gnl|bcl2dbpro|E7FBJ6_BAD-01 BCL2-associated agonist of cell death protein OS=[Eukaryota] Danio rerio GN=BAD (length=145 residues).
MENTSHDHQDDSSTLDEKERSHLKGTIKNHGQHQDRTSANISPQGRVRLYSESQVYTVSRWQDTETQDGASVEENGDGLP
FRGRSQSAPAALWKAKKYGRQLRRMSDEFDTWLDKGVSKTPNSQKQTYRGWFSFLWSPKEEEGRE
>gnl|bcl2dbpro|Q0GKC7_BMF-01 Bcl2 modifying factor protein OS=[Eukaryota] Danio rerio GN=BMF (length=142 residues).
MDEDEDDVFRKGLQHWPPPHLQIKQTELAGRPAGSRNGMLLCRHLQQHGHFLYGNAELLVLAASSRAQPPDVVLRQNVSP
MERPEPRPAQSVETLIGQKLQLIGDQFYQEHIMHHQRPQDPLWRRVATAVLTLLFGARENRR
>gnl|bcl2dbpro|Q0GKC8_PMAIP1-01 Phorbol-12-myristate-13-acetate-induced protein 1 protein OS=[Eukaryota] Danio rerio GN=PMAIP1 (length=45 residues).
MAKKEQTAVVECAQQLRNIGDLLNWKYKLLELIVTLQKIQMEGKR
>gnl|bcl2dbpro|Q4V925_BAD-02 BCL2-associated agonist of cell death protein OS=[Eukaryota] Danio rerio GN=BAD (length=146 residues).
MAHMFNISDDSETETMEDSEDSSLDKHKSGSAQKKQHLTVPDRLKGEQLGRQRNLSMNEEDLLETGVAEDPHMLGDPFRP
RSRSAPPALWAAKKYGQQLRRMSDEFDKGMKRVKSAGTARQMSQSPSWLAFLWSHKESDAESRPAE
>gnl|bcl2dbpro|Q4V925_BAD-03 BCL2-associated agonist of cell death protein OS=[Eukaryota] Danio rerio GN=BAD (length=146 residues).
MAHMFNISDDSETETMEDSEDSSLDKHKSGSAQKKQHLTVPDRLKGEQLGRQRNLSMNEEDLLETGVAEDPHMLGDPFRP
RSRSAPPALWAAKKYGQQLRRMSDEFDKGMKRVKSAGTARQMSQSPSWLAFLWSHKESDAESRPAE
>gnl|bcl2dbpro|Q4V925_BAD-04 BCL2-associated agonist of cell death protein OS=[Eukaryota] Danio rerio GN=BAD (length=147 residues).
MAHMFNISDDSETETMEDSEDSSLDKHKSGSAQKKQHLTVPDRLKGEQLGRQRNLSMNEEDLLETGVAEDPHMLGDPFRP
RSRSAPPALWAAKKYGQQLRRMSDEFDKGQMKRVKSAGTARQMSQSPSWLAFLWSHKESDAESRPAE
>gnl|bcl2dbpro|Q4V925_BAD-01 BCL2-associated agonist of cell death protein OS=[Eukaryota] Danio rerio GN=BAD (length=147 residues).
MAHMFNISDDSETETMEDSEDSSLDKHKSGSAQKKQHLTVPDRLKGEQLGRQRNLSMNEEDLLETGVAEDPHMLGDPFRP
RSRSAPPALWAAKKYGQQLRRMSDEFDKGQMKRVKSAGTARQMSQSPSWLAFLWSHKESDAESRPAE
© 1998-2018