Dataset for protein Bmf of organism Danio rerio

[Download (right click)]

1 sequence(s)

>gnl|bcl2dbpro|Q0GKC7_BMF-01 Bcl2 modifying factor protein OS=[Eukaryota] Danio rerio GN=BMF (length=142 residues).
MDEDEDDVFRKGLQHWPPPHLQIKQTELAGRPAGSRNGMLLCRHLQQHGHFLYGNAELLVLAASSRAQPPDVVLRQNVSP
MERPEPRPAQSVETLIGQKLQLIGDQFYQEHIMHHQRPQDPLWRRVATAVLTLLFGARENRR
© 1998-2018