Dataset for protein Bim of organism Danio rerio

[Download (right click)] [Alignment] [Repertoires]

2 sequence(s)

>gnl|bcl2dbpro|B2KKY9_BCL2L11-01 BCL2-like 11 protein OS=[Eukaryota] Danio rerio GN=BCL2L11 (length=176 residues).
MSDTSREQTLANGPASQGSGESTGGGVVLPAGHFDFPQPGEGDPLRGGISMSNNQSRSPMNRTFSRSSSGYFSVDSDSVP
GSPLMPNISEAQDGQNDEVWLSEHSHQHLQMAAPVAALPPEMVVARELRRIGDEFNRLYCEAGAGVNQLRAPNEHAIVLW
MNVIIGRLVHFFLRRR
>gnl|bcl2dbpro|B8JK68_BCL2L11-01 BCL2-like 11 protein OS=[Eukaryota] Danio rerio GN=BCL2L11 (length=176 residues).
MSDTSREQTLANGPASQGSGESTGGGVVLPAGHFDFPQPGEGDPLRGGISMSNNQSRSPMNRTFSRSSSGYFSVDSDSVP
GSPLMPNISEAQDGQNDEVWLSEHSHQHLQMAAPVAALPPEMVVARELRRIGDEFNRLYCEAGAGVNQLHAPNEHAIVLW
MNDIIGRLVHFFLRRR
© 1998-2018