Dataset for protein Bad of organism Danio rerio

[Download (right click)] [Alignment] [Repertoires]

6 sequence(s)

>gnl|bcl2dbpro|A7MCM4_BAD-01 BCL2-associated agonist of cell death protein OS=[Eukaryota] Danio rerio GN=BAD (length=147 residues).
MAHMFNISDDSETETMEDSEASSLDKHKSGSAQKKQHLTVPDRLKGEQLGRQRNLSMNEEDLLETGVAEDPHMLGDPFRP
RSRSAPPALWAAKKYGQQLRRMSDEFDKGQMKRVKSAGTARQMSQSPSWLAFLWSHKESDAESRPAE
>gnl|bcl2dbpro|E7FBJ6_BAD-01 BCL2-associated agonist of cell death protein OS=[Eukaryota] Danio rerio GN=BAD (length=145 residues).
MENTSHDHQDDSSTLDEKERSHLKGTIKNHGQHQDRTSANISPQGRVRLYSESQVYTVSRWQDTETQDGASVEENGDGLP
FRGRSQSAPAALWKAKKYGRQLRRMSDEFDTWLDKGVSKTPNSQKQTYRGWFSFLWSPKEEEGRE
>gnl|bcl2dbpro|Q4V925_BAD-02 BCL2-associated agonist of cell death protein OS=[Eukaryota] Danio rerio GN=BAD (length=146 residues).
MAHMFNISDDSETETMEDSEDSSLDKHKSGSAQKKQHLTVPDRLKGEQLGRQRNLSMNEEDLLETGVAEDPHMLGDPFRP
RSRSAPPALWAAKKYGQQLRRMSDEFDKGMKRVKSAGTARQMSQSPSWLAFLWSHKESDAESRPAE
>gnl|bcl2dbpro|Q4V925_BAD-03 BCL2-associated agonist of cell death protein OS=[Eukaryota] Danio rerio GN=BAD (length=146 residues).
MAHMFNISDDSETETMEDSEDSSLDKHKSGSAQKKQHLTVPDRLKGEQLGRQRNLSMNEEDLLETGVAEDPHMLGDPFRP
RSRSAPPALWAAKKYGQQLRRMSDEFDKGMKRVKSAGTARQMSQSPSWLAFLWSHKESDAESRPAE
>gnl|bcl2dbpro|Q4V925_BAD-04 BCL2-associated agonist of cell death protein OS=[Eukaryota] Danio rerio GN=BAD (length=147 residues).
MAHMFNISDDSETETMEDSEDSSLDKHKSGSAQKKQHLTVPDRLKGEQLGRQRNLSMNEEDLLETGVAEDPHMLGDPFRP
RSRSAPPALWAAKKYGQQLRRMSDEFDKGQMKRVKSAGTARQMSQSPSWLAFLWSHKESDAESRPAE
>gnl|bcl2dbpro|Q4V925_BAD-01 BCL2-associated agonist of cell death protein OS=[Eukaryota] Danio rerio GN=BAD (length=147 residues).
MAHMFNISDDSETETMEDSEDSSLDKHKSGSAQKKQHLTVPDRLKGEQLGRQRNLSMNEEDLLETGVAEDPHMLGDPFRP
RSRSAPPALWAAKKYGQQLRRMSDEFDKGQMKRVKSAGTARQMSQSPSWLAFLWSHKESDAESRPAE
© 1998-2018