Dataset for protein Unclassified of organism Cyprinodon variegatus

[Download (right click)]

1 sequence(s)

>gnl|bcl2dbpro|A0A3Q2FS95_uncBCL2L11-01 Putative BCL2-like 11 protein OS=[Eukaryota] Cyprinodon variegatus (length=242 residues).
MNDMQSSRPPNLRDGSTEVTSEEGTEGDPAASARKPRLSKRRERSCALQPGAAGTAGGGRDPDSDSPPCSVSPASLDVFR
SRSIFRPTRRSSSGYFSFDCDSLPSSPLTPHPVTADKATQTASPTGQVMKHALQRMAVEQGGQGAPGLHGHSAIPYSEWE
GIAARDMQSETFGRQLRTIGDEYNNHLLRMAGRHRRNIVPLNLMPHIQQEPVAMLCVGLLLLLIGRIMYLQGSTSSHDHP
QV
© 1998-2019